Shivareddywedslakshmichaitanya.com is using 4 services which we detected on its website. The major ones are YHC Corporation for hosting the website, aakrutisolutions.com for DNS management, pdr ltd. d/b/a publicdomainregistry.com as Registrar and shivareddywedslakshmichaitanya.com for email services The site was offline when this report was compiled on 11 December 2019 21:57. shivareddywedslakshmichaitanya.com is hosted in United States of America .
After checking the site records, we found that it is 7 years 6 months old and will expire on 04 November 2017. For more registration details, refer to this section. The site uses a SSL Certificate issued by Comodo Group to protect the privacy of its users. Homepage is in English and contain 1 external links.
Services used by shivareddywedslakshmichaitanya.com
Find what are the main services utilised by shivareddywedslakshmichaitanya.com.Registration Metadata
Registration details tell about a website past and future. The information is critical for websites assessment.Complete registration information text
Domain Name: SHIVAREDDYWEDSLAKSHMICHAITANYA.COM Registrar: PDR LTD. D/B/A PUBLICDOMAINREGISTRY.COM Sponsoring Registrar IANA ID: 303 Whois Server: whois.PublicDomainRegistry.com Referral URL: Name Server: NS1.AAKRUTISOLUTIONS.COM Name Server: NS2.AAKRUTISOLUTIONS.COM Status: clientTransferProhibited Updated Date: 04-nov-2016 Creation Date: 04-nov-2016 Expiration Date: 04-nov-2017