Windshieldreplacementnyackny.info is using 2 services which we detected on its website. The major ones are rookdns.com for DNS management and Go Daddy as Registrar The site was offline when this report was compiled on 08 December 2019 23:31. windshieldreplacementnyackny.info is hosted in Switzerland and owned by DOMAIN MAY BE FOR SALE, CHECK AFTERNIC.COM Domain Admin (). Actual information of owners might be masked by privacy protection services offered by website registrar.
After checking the site records, we found that it is 6 years 10 months old . For more registration details, refer to this section. We didn't find any SSL certificate present on the website which is bad for users privacy.
Services used by windshieldreplacementnyackny.info
Find what are the main services utilised by windshieldreplacementnyackny.info.
Server Tech
Microsoft-IIS/7.5
Compression Algo
-
Generator
-
SSL Certificate
-
Hosting Account
-
DNS Served by
rookdns.com
Google Analytics
Absent
External Links
-
Language
-
Origin country
Switzerland
Primary IP Address
141.8.224.93
Owner Country
-
Email server
-
Registration Metadata
Registration details tell about a website past and future. The information is critical for websites assessment.
DOMAIN MAY BE FOR SALE, CHECK AFTERNIC.COM Domain Admin
Owner
Domain Registries Foundation
Corporate
Email
-
Country
Absent
IPv6
11 July 2017
Website Registered
11 July 2017
Update
-
Domain Expiration
Complete registration information text
Domain Name: WINDSHIELDREPLACEMENTNYACKNY.INFO Registry Domain ID: D503300000041302603-LRMS Registrar WHOIS Server: Registrar URL: Updated Date: 2017-07-11T22:30:59Z Creation Date: 2017-07-11T22:30:58Z Registry Expiry Date: 2018-07-11T22:30:58Z Registrar Registration Expiration Date: Registrar: GoDaddy.com, LLC Registrar IANA ID: 146 Registrar Abuse Contact Email: Registrar Abuse Contact Phone: Reseller: Domain Status: clientDeleteProhibited Domain Status: clientRenewProhibited Domain Status: clientTransferProhibited Domain Status: clientUpdateProhibited Domain Status: serverTransferProhibited Domain Status: addPeriod Registry Registrant ID: C206337998-LRMS Registrant Name: DOMAIN MAY BE FOR SALE, CHECK AFTERNIC.COM Domain Admin Registrant Organization: Domain Registries Foundation Registrant Street: Ramon Arias Avenue, Ropardi Building Registrant Street: Office 3C, PO Box 0823-03015 Registrant City: Panama City Registrant State/Province: Panama Registrant Postal Code: 0823 Registrant Country: PA Registrant Phone: +507.8365439 Registrant Phone Ext: Registrant Fax: Registrant Fax Ext: Registrant Email: Registry Admin ID: C206338024-LRMS Admin Name: DOMAIN MAY BE FOR SALE, CHECK AFTERNIC.COM Domain Admin Admin Organization: Domain Registries Foundation Admin Street: Ramon Arias Avenue, Ropardi Building Admin Street: Office 3C, PO Box 0823-03015 Admin City: Panama City Admin State/Province: Panama Admin Postal Code: 0823 Admin Country: PA Admin Phone: +507.8365439 Admin Phone Ext: Admin Fax: Admin Fax Ext: Admin Email: Registry Tech ID: C206338013-LRMS Tech Name: DOMAIN MAY BE FOR SALE, CHECK AFTERNIC.COM Domain Admin Tech Organization: Domain Registries Foundation Tech Street: Ramon Arias Avenue, Ropardi Building Tech Street: Office 3C, PO Box 0823-03015 Tech City: Panama City Tech State/Province: Panama Tech Postal Code: 0823 Tech Country: PA Tech Phone: +507.8365439 Tech Phone Ext: Tech Fax: Tech Fax Ext: Tech Email: Registry Billing ID: C206338028-LRMS Billing Name: DOMAIN MAY BE FOR SALE, CHECK AFTERNIC.COM Domain Admin Billing Organization: Domain Registries Foundation Billing Street: Ramon Arias Avenue, Ropardi Building Billing Street: Office 3C, PO Box 0823-03015 Billing City: Panama City Billing State/Province: Panama Billing Postal Code: 0823 Billing Country: PA Billing Phone: +507.8365439 Billing Phone Ext: Billing Fax: Billing Fax Ext: Billing Email: Name Server: NS7.ROOKDNS.COM Name Server: NS8.ROOKDNS.COM DNSSEC: unsigned URL of the ICANN Whois Inaccuracy Complaint Form: For more information on Whois status codes, please visit Access to AFILIAS WHOIS information is provided to assist persons in determining the contents of a domain name registration record in the Afilias registry database. The data in this record is provided by Afilias Limited for informational purposes only, and Afilias does not guarantee its accuracy. This service is intended only for query-based access. You agree that you will use this data only for lawful purposes and that, under no circumstances will you use this data to(a) allow, enable, or otherwise support the transmission by e-mail, telephone, or facsimile of mass unsolicited, commercial advertising or solicitations to entities other than the data recipient's own existing customers; or (b) enable high volume, automated, electronic processes that send queries or data to the systems of Registry Operator, a Registrar, or Afilias except as reasonably necessary to register domain names or modify existing registrations. All rights reserved. Afilias reserves the right to modify these terms at any time. By submitting this query, you agree to abide by this policy.